PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_53545g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family SRS
Protein Properties Length: 557aa    MW: 58304.4 Da    PI: 8.091
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_53545g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702198.71.8e-613314874150
         DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskke 99 
                    ++++CqdCGnqakkdC h RCRtCCksrgfdC+th+kstWvpaakrre+qq++aaa +   a + + ++kr r  +s++++++s+t++s ++++++
  MA_53545g0010 331 NSTTCQDCGNQAKKDCRHLRCRTCCKSRGFDCSTHLKSTWVPAAKRREKQQAEAAAIA---AGHPRPKTKRARFVSSSNATTTSHTSTSATTPPRS 423
                    6789*********************************************999888744...345677888999999999999************99 PP

         DUF702 100 letss.............lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydq 150
                    ++++s             lP+e++++avf+cvrv++++dg +e+aYq++v+igGh+f+G+Lyd 
  MA_53545g0010 424 SDINStqiahqdlnfkanLPAEIKAQAVFKCVRVTAIEDGVDEFAYQATVKIGGHIFRGVLYDD 487
                    9999999*******************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.4E-56332487IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.8E-26334376IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.1E-24442486IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MEEVRGCRGS ELWLIVATVA PAVASTGGAS GGPRRTEGGI PEWVSSSSSS SLQLQPRGVI  60
KERDFSLGFN GGGGGAGGVT HSAGSTSTSH THHHSRYTLV RPLSYGYPSG IEMAVGGMLG  120
AGVGESPAGG SGPYAGGPAR LGSISGGSGG INIVNRESLR DVVTRAGGGG GGGTEDFVSL  180
YTRVRREDDP TSAPRGGGSF VAYATTPRTV DDPDHHANIQ SSMPVLSSAH HREDDRGVDQ  240
GEIQVWQQAR DLRGDGNQES KEKAMASQMR VMEISGGQQA PERRSNCELG ATGDQSQLSN  300
VENKNGGGGL AVTVAAMPKT NTNPNTITNA NSTTCQDCGN QAKKDCRHLR CRTCCKSRGF  360
DCSTHLKSTW VPAAKRREKQ QAEAAAIAAG HPRPKTKRAR FVSSSNATTT SHTSTSATTP  420
PRSSDINSTQ IAHQDLNFKA NLPAEIKAQA VFKCVRVTAI EDGVDEFAYQ ATVKIGGHIF  480
RGVLYDDQRA DTSNLHSNLP DLHLGGTTTM ASTSAMIDPT AGGGVYGASS SNILGGMDYR  540
NPISTQHQTM FDMQCLS
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1170060.0BT117006.1 Picea glauca clone GQ03811_A07 mRNA sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13131549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.22e-39Lateral root primordium (LRP) protein-related